Paralogue Annotation for ANK2 residue 1092

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1092
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1092

No paralogue variants have been mapped to residue 1092 for ANK2.



ANK2VVLRSENGDSWKEHFCDYTEDELNEILNGM>D<EVLDSPEDLEKKRICRIITRDFPQYFAVVS1122
ANK1VVLRSENGSVWKEHRSRYGESYLDQILNGM>D<EELGSLEELEKKRVCRIITTDFPLYFVIMS1067
ANK3IVLRSENGETWKEHQFDSKNEDLTELLNGM>D<EELDSPEELGKKRICRIITKDFPQYFAVVS1138
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1092Vc.3275A>T Putative BenignSIFT: deleterious
Polyphen: probably damaging