Paralogue Annotation for ANK2 residue 1119

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1119
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1119

No paralogue variants have been mapped to residue 1119 for ANK2.



ANK2NGMDEVLDSPEDLEKKRICRIITRDFPQYF>A<VVSRIKQDSNLIGPEGGVLSSTVVPQVQAV1149
ANK1NGMDEELGSLEELEKKRVCRIITTDFPLYF>V<IMSRLCQDYDTIGPEGGSLKSKLVPLVQAT1094
ANK3NGMDEELDSPEELGKKRICRIITKDFPQYF>A<VVSRIKQESNQIGPEGGILSSTTVPLVQAS1165
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1119Vc.3356C>T Putative BenignSIFT: tolerated
Polyphen: probably damaging