Paralogue Annotation for ANK2 residue 1214

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1214
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1214

No paralogue variants have been mapped to residue 1214 for ANK2.



ANK2SPIVTLEPRRRKFHKPITMTIPVPKASSDV>M<LNGFGGDA-PTLRLLCSITGGTTPAQWEDI1243
ANK1SPIVTVEPRRRKFHRPIGLRIPLPPSWTDN>P<RDSGEGDT-TSLRLLCSVIGGTDQAQWEDI1188
ANK3SPIVTVEPRRRKFHKPITMTIPVPPPSGEG>V<SNGYKGDTTPNLRLLCSITGGTSPAQWEDI1260
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M1214Ic.3642G>A Putative BenignSIFT: tolerated
Polyphen: benign