Paralogue Annotation for ANK2 residue 1284

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1284
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1284

No paralogue variants have been mapped to residue 1284 for ANK2.



ANK2ECVSFTTNVSARFWLIDCRQIQESVTFASQ>V<YREIICVPYMAKFVVFAKSHDPIEARLRCF1314
ANK1ECANFTTNVSARFWLSDCPRTAEAVNFATL>L<YKELTAVPYMAKFVIFAKMNDPREGRLRCY1259
ANK3DCVSFTTNVSARFWLADCHQVLETVGLATQ>L<YRELICVPYMAKFVVFAKMNDPVESSLRCF1331
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1284Ic.3850G>A Putative BenignSIFT:
Polyphen: possibly damaging