Paralogue Annotation for ANK2 residue 1339

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1339
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1339

No paralogue variants have been mapped to residue 1339 for ANK2.



ANK2ARLRCFCMTDDKVDKTLEQQENFAEVARSR>D<VEVLEGKPIYVDCFGNLVPLTKSGQHHIFS1369
ANK1GRLRCYCMTDDKVDKTLEQHENFVEVARSR>D<IEVLEGMSLFAELSGNLVPVKKAAQQRSFH1314
ANK3SSLRCFCMTDDKVDKTLEQQENFEEVARSK>D<IEVLEGKPIYVDCYGNLAPLTKGGQQLVFN1386
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1339Ec.4017T>G UnknownSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510