Paralogue Annotation for ANK2 residue 1374

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1374
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1374

No paralogue variants have been mapped to residue 1374 for ANK2.



ANK2EGKPIYVDCFGNLVPLTKSGQHHIFSFFAF>K<ENRLPLFVKVRDTTQEPCGRLSFMKEPKST1404
ANK1EGMSLFAELSGNLVPVKKAAQQRSFHFQSF>R<ENRLAMPVKVRDSSREPGGSLSFLRKAMKY1349
ANK3EGKPIYVDCYGNLAPLTKGGQQLVFNFYSF>K<ENRLPFSIKIRDTSQEPCGRLSFLKEPKTT1421
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K1374Rc.4121A>G Putative BenignSIFT: tolerated
Polyphen: probably damaging