Paralogue Annotation for ANK2 residue 1406

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1406
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1406

No paralogue variants have been mapped to residue 1406 for ANK2.



ANK2NRLPLFVKVRDTTQEPCGRLSFMKEPKSTR>G<LVHQAICNLNITLPIYTKESESDQEQE---1433
ANK1NRLAMPVKVRDSSREPGGSLSFLRKAMKYE>D<TQ-HILCHLNITMPPCAKGSGAEDRRR---1377
ANK3NRLPFSIKIRDTSQEPCGRLSFLKEPKTTK>G<LPQTAVCNLNITLPAHKKETESDQDDEIEK1453
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1406Cc.4216G>T BenignSIFT: deleterious
Polyphen: possibly damaging
ReportsPutative Benign Defining the cellular phenotype of "ankyrin-B syndrome" variants: human ANK2 variants associated with clinical phenotypes display a spectrum of activities in cardiomyocytes. Circulation. 2007 115(4):432-41. 17242276
Unknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510
p.G1406Dc.4217G>A Putative BenignSIFT:
Polyphen: