Paralogue Annotation for ANK2 residue 1425

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1425
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1425

No paralogue variants have been mapped to residue 1425 for ANK2.



ANK2LSFMKEPKSTRGLVHQAICNLNITLPIYTK>E<SESDQEQE--------EEIDMTSE--KNDE1445
ANK1LSFLRKAMKYEDTQ-HILCHLNITMPPCAK>G<SGAEDRRR--------TPTPLALR--YSIL1389
ANK3LSFLKEPKTTKGLPQTAVCNLNITLPAHKK>E<TESDQDDEIEKTDRRQSFASLALRKRYSYL1472
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1425Gc.4274A>G ConflictSIFT: tolerated
Polyphen: possibly damaging
ReportsInherited ArrhythmiaLQTS Ankyrin-B mutation causes type 4 long-QT cardiac arrhythmia and sudden cardiac death. Nature. 2003 421(6923):634-9. 12571597
Inherited ArrhythmiaLQTS A cardiac arrhythmia syndrome caused by loss of ankyrin-B function. Proc Natl Acad Sci U S A. 2004 101(24):9137-42. 15178757
Inherited ArrhythmiaLQTS Dysfunction in ankyrin-B-dependent ion channel and transporter targeting causes human sinus node disease. Proc Natl Acad Sci U S A. 2008 105(40):15617-22. 18832177
Unknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510