Paralogue Annotation for ANK2 residue 1539

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1539
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1539

No paralogue variants have been mapped to residue 1539 for ANK2.



ANK2EIVER--------VKEDLEKVNEILRSGTC>T<RDESSVQSSRSE------------------1551
ANK1------------------------------>-<------------------------------
ANK3PLKGLASNSTFSSRTSPVTTAGSLLERSSI>T<MTPPASPKSNINMYSSSLPFKSIITSAAPL1670
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1539Rc.4616C>G Putative BenignSIFT:
Polyphen: benign