Paralogue Annotation for ANK2 residue 155

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 155
Reference Amino Acid: N - Asparagine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 155

No paralogue variants have been mapped to residue 155 for ANK2.



ANK2AQSQNGFTPLYMAAQENHIDVVKYLLENGA>N<QSTATEDGFTPLAVALQQGHNQAVAILLEN185
ANK1AQSQKGFTPLYMAAQENHLEVVKFLLENGA>N<QNVATEDGFTPLAVALQQGHENVVAHLINY166
ANK3AQSQNGFTPLYMAAQENHLEVVKFLLDNGA>S<QSLATEDGFTPLAVALQQGHDQVVSLLLEN195
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N155Tc.464A>C Putative BenignSIFT: deleterious
Polyphen: probably damaging