Paralogue Annotation for ANK2 residue 1634

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1634
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1634

No paralogue variants have been mapped to residue 1634 for ANK2.



ANK2-------------LPKEQLQTVQDKAGKKC>E<ALAVGRSSEKEGKDIPPDETQSTQKQHKPS1664
ANK1------------------------------>-<------------------------------
ANK3SIITVPVYSVVNVLPEPALKKLPDSNSFTK>S<AAALLSPIKTLTTETHPQPHFSRTSSPVKS1878
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1634Kc.4900G>A Putative BenignSIFT: tolerated
Polyphen: benign