Paralogue Annotation for ANK2 residue 166

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 166
Reference Amino Acid: P - Proline
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 166

No paralogue variants have been mapped to residue 166 for ANK2.



ANK2MAAQENHIDVVKYLLENGANQSTATEDGFT>P<LAVALQQGHNQAVAILLENDTKGKVRLPAL196
ANK1MAAQENHLEVVKFLLENGANQNVATEDGFT>P<LAVALQQGHENVVAHLINYGTKGKVRLPAL177
ANK3MAAQENHLEVVKFLLDNGASQSLATEDGFT>P<LAVALQQGHDQVVSLLLENDTKGKVRLPAL206
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P166Ac.496C>G Putative BenignSIFT: deleterious
Polyphen: probably damaging