Paralogue Annotation for ANK2 residue 1664

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1664
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1664

No paralogue variants have been mapped to residue 1664 for ANK2.



ANK2EALAVGRSSEKEGKDIPPDETQSTQKQHKP>S<LGIKKPVRRKLKEKQKQKEEGLQASAEKAE1694
ANK1------------------------------>-<------------------------------
ANK3SAAALLSPIKTLTTETHPQPHFSRTSSPVK>S<SLFLAPSALKLSTPSSLSSSQEILKDVAEM1908
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1664Tc.4991G>C Putative BenignSIFT: tolerated
Polyphen: benign