Paralogue Annotation for ANK2 residue 1679

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1679
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1679

No paralogue variants have been mapped to residue 1679 for ANK2.



ANK2IPPDETQSTQKQHKPSLGIKKPVRRKLKEK>Q<KQKEEGLQASAEKAELKKGSSEESLGEDPG1709
ANK1------------------------------>-<------------------------------
ANK3THPQPHFSRTSSPVKSSLFLAPSALKLSTP>S<SLSSSQEILKDVAEMKEDLMRMTAILQTDV1923
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q1679Kc.5035C>A Putative BenignSIFT: tolerated
Polyphen: benign