Paralogue Annotation for ANK2 residue 169

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 169
Reference Amino Acid: V - Valine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 169

No paralogue variants have been mapped to residue 169 for ANK2.



ANK2QENHIDVVKYLLENGANQSTATEDGFTPLA>V<ALQQGHNQAVAILLENDTKGKVRLPALHIA199
ANK1QENHLEVVKFLLENGANQNVATEDGFTPLA>V<ALQQGHENVVAHLINYGTKGKVRLPALHIA180
ANK3QENHLEVVKFLLDNGASQSLATEDGFTPLA>V<ALQQGHDQVVSLLLENDTKGKVRLPALHIA209
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V169Lc.505G>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging