Paralogue Annotation for ANK2 residue 1714

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1714
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1714

No paralogue variants have been mapped to residue 1714 for ANK2.



ANK2EGLQASAEKAELKKGSSEESLGEDPGLAPE>P<LPTVKATSPLIEETPIGSIKDKVKALQKRV1744
ANK1------------------------------>-<------------------------------
ANK3SQEILKDVAEMKEDLMRMTAILQTDVPEEK>P<FQPELPKEGRIDDEEPFKIVEKVKEDLVKV1958
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1714Rc.5141C>G Putative BenignSIFT: deleterious
Polyphen: benign