Paralogue Annotation for ANK2 residue 1739

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1739
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1739

No paralogue variants have been mapped to residue 1739 for ANK2.



ANK2GLAPEPLPTVKATSPLIEETPIGSIKDKVK>A<LQKRVEDEQK--------------------1749
ANK1------------------------------>-<------------------------------
ANK3VPEEKPFQPELPKEGRIDDEEPFKIVEKVK>E<DLVKVSEILKKDVCVDNKGSPKSPKSDKGH1983
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1739Tc.5215G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging