Paralogue Annotation for ANK2 residue 1799

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1799
Reference Amino Acid: T - Threonine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1799

No paralogue variants have been mapped to residue 1799 for ANK2.



ANK2THRPHPAASPSLKSERHAPGSPSPKTERHS>T<LSS---------------------SAKTER1808
ANK1------------------------------>-<------------------------------
ANK3EERQKRVLKPAIALQEHKLKMPPASMRTST>S<EKELCKMADSFFGTDTILESPDDFSQHDQD2121
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1799Ic.5396C>T Putative BenignSIFT:
Polyphen: benign