Paralogue Annotation for ANK2 residue 1872

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1872
Reference Amino Acid: S - Serine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1872

No paralogue variants have been mapped to residue 1872 for ANK2.



ANK2TEKHSPVSPSTKTERHSPVSSTKTERHPPV>S<PSGKTDKRPPVSPSGR-TEKHPPVSPG-RT1900
ANK1------------------------------>-<------------------------------
ANK3EVPIPPVITETRTEVVHVIRSYDPSAGDVP>Q<TQPEEPVSPKPSPTFMELEPKPTTSSIKEK2215
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1872Lc.5615C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging