Paralogue Annotation for ANK2 residue 1884

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1884
Reference Amino Acid: S - Serine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1884

No paralogue variants have been mapped to residue 1884 for ANK2.



ANK2TERHSPVSSTKTERHPPVSPSGKTDKRPPV>S<PSGR-TEKHPPVSPG-RTEKRLPVSPSGRT1912
ANK1------------------------------>-<------------------------------
ANK3TEVVHVIRSYDPSAGDVPQTQPEEPVSPKP>S<PTFMELEPKPTTSSIKEKVKAFQMKASSEE2227
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1884Lc.5651C>T Putative BenignSIFT: tolerated
Polyphen: benign