Paralogue Annotation for ANK2 residue 1892

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1892
Reference Amino Acid: H - Histidine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1892

No paralogue variants have been mapped to residue 1892 for ANK2.



ANK2TKTERHPPVSPSGKTDKRPPVSPSGR-TEK>H<PPVSPG-RTEKRLPVSPSGRTDKHQPVSTA1921
ANK1------------------------------>-<------------------------------
ANK3YDPSAGDVPQTQPEEPVSPKPSPTFMELEP>K<PTTSSIKEKVKAFQMKASSEEDDHNRVLSK2236
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H1892Pc.5675A>C Putative BenignSIFT: deleterious
Polyphen: benign