Paralogue Annotation for ANK2 residue 19

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 19
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 19

No paralogue variants have been mapped to residue 19 for ANK2.



ANK2MMNEDAAQKSDSGEKFNG--------->S<SQ-RRKRPKKSDSNASFLRAARAGNLDKVV48
ANK1MPYSVGF-------------------->-<--------READAATSFLRAARSGNLDKAL29
ANK3MAHAASQLKKNRDLEINAEEEPEKKRK>H<RKRSRDRKKKSDANASYLRAARAGHLEKAL58
cons                           > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S19Nc.56G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510
p.S19Gc.55A>G Putative BenignSIFT:
Polyphen: