Paralogue Annotation for ANK2 residue 1918

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1918
Reference Amino Acid: V - Valine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1918

No paralogue variants have been mapped to residue 1918 for ANK2.



ANK2TEKHPPVSPG-RTEKRLPVSPSGRTDKHQP>V<STAG-KTEKHLPVSPSGKTEKQPPVSPTSK1947
ANK1------------------------------>-<------------------------------
ANK3LEPKPTTSSIKEKVKAFQMKASSEEDDHNR>V<LSKGMRVKEETHITTTTRMVYHSPPGGEGA2263
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1918Ac.5753T>C Putative BenignSIFT:
Polyphen: benign
p.V1918Ic.5752G>A Putative BenignSIFT: tolerated
Polyphen: benign