Paralogue Annotation for ANK2 residue 1973

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1973
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1973

No paralogue variants have been mapped to residue 1973 for ANK2.



ANK2SPTSKTERIEETMSVRELMKAFQSGQDPSK>H<KTGLFEHKSAKQKQPQEKGKVR--------1995
ANK1------------------------------>-<------------------------------
ANK3GGEGASERIEETMSVHDIMKAFQSGRDPSK>E<LAGLFEHKSAVSPDVHKSAAETSAQHAEKD2319
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H1973Nc.5917C>A Putative BenignSIFT:
Polyphen: probably damaging
p.H1973Yc.5917C>T Putative BenignSIFT:
Polyphen: probably damaging