Paralogue Annotation for ANK2 residue 1976

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1976
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1976

No paralogue variants have been mapped to residue 1976 for ANK2.



ANK2SKTERIEETMSVRELMKAFQSGQDPSKHKT>G<LFEHKSAKQKQPQEKGKVR-----------1995
ANK1------------------------------>-<------------------------------
ANK3GASERIEETMSVHDIMKAFQSGRDPSKELA>G<LFEHKSAVSPDVHKSAAETSAQHAEKDNQM2322
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1976Vc.5927G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging