Paralogue Annotation for ANK2 residue 1985

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1985
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1985

No paralogue variants have been mapped to residue 1985 for ANK2.



ANK2MSVRELMKAFQSGQDPSKHKTGLFEHKSAK>Q<KQPQEKGKVR--------------------1995
ANK1------------------------------>-<------------------------------
ANK3MSVHDIMKAFQSGRDPSKELAGLFEHKSAV>S<PDVHKSAAETSAQHAEKDNQMKPKLERIIE2331
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q1985Kc.5953C>A Putative BenignSIFT: tolerated
Polyphen: benign