Paralogue Annotation for ANK2 residue 1986

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1986
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1986

No paralogue variants have been mapped to residue 1986 for ANK2.



ANK2SVRELMKAFQSGQDPSKHKTGLFEHKSAKQ>K<QPQEKGKVR--------------------V1996
ANK1------------------------------>-<------------------------------
ANK3SVHDIMKAFQSGRDPSKELAGLFEHKSAVS>P<DVHKSAAETSAQHAEKDNQMKPKLERIIEV2332
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K1986Ec.5956A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging
p.K1986Nc.5958G>C Putative BenignSIFT: deleterious
Polyphen: probably damaging