Paralogue Annotation for ANK2 residue 2145

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2145
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2145

No paralogue variants have been mapped to residue 2145 for ANK2.



ANK2DKYQQFRLSEETEKAQLHLDQVLTSPFNTT>F<PLDYMKDEFLPA---------------LSL2160
ANK1------------------------------>-<------------------------------
ANK3DKRSREKIATAPKKEILSKIYKDVSENGVG>K<VSKDEHFDKVTVLHYSGNVSSPKHAMWMRF2559
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F2145Yc.6434T>A Putative BenignSIFT: deleterious
Polyphen: probably damaging