Paralogue Annotation for ANK2 residue 2211

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2211
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2211

No paralogue variants have been mapped to residue 2211 for ANK2.



ANK2PCGSLMEGTPQISSEESYKHEGLAETPETS>P<ESLSFSPKKSEEQTGETKESTKTET--TTE2239
ANK1------------------------------>-<------------------------------
ANK3TVKEAEEKLTEVSQFFRDKTEKLNDELQ-S>P<EKKA-RPKNGKEYSSQSPTSSSPEKVLLTE2638
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P2211Tc.6631C>A Putative BenignSIFT: deleterious
Polyphen: probably damaging