Paralogue Annotation for ANK2 residue 2244

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2244
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2244

No paralogue variants have been mapped to residue 2244 for ANK2.



ANK2FSPKKSEEQTGETKESTKTET--TTEIRSE>K<EHPTTKDITGGSEERGATVTEDSET-----2269
ANK1------------------------------>-<------------------------------
ANK3-RPKNGKEYSSQSPTSSSPEKVLLTELLAS>N<DE-WVKARQHGPDGQGFPKAEEKAPSLPSS2672
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2244Rc.6731A>G Putative BenignSIFT:
Polyphen: benign