Paralogue Annotation for ANK2 residue 2262

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2262
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2262

No paralogue variants have been mapped to residue 2262 for ANK2.



ANK2TET--TTEIRSEKEHPTTKDITGGSEERGA>T<VTEDSET-----------------------2269
ANK1------------------------------>-<------------------------------
ANK3PEKVLLTELLASNDE-WVKARQHGPDGQGF>P<KAEEKAPSLPSSPEKMVLSQQTEDSKSTVE2690
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2262Ac.6784A>G UnknownSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510