Paralogue Annotation for ANK2 residue 2265

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2265
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2265

No paralogue variants have been mapped to residue 2265 for ANK2.



ANK2--TTEIRSEKEHPTTKDITGGSEERGATVT>E<DSET--------------------------2269
ANK1------------------------------>-<------------------------------
ANK3VLLTELLASNDE-WVKARQHGPDGQGFPKA>E<EKAPSLPSSPEKMVLSQQTEDSKSTVEAKG2693
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2265Ac.6794A>C UnknownSIFT:
Polyphen: benign