Paralogue Annotation for ANK2 residue 2316

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2316
Reference Amino Acid: C - Cysteine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2316

No paralogue variants have been mapped to residue 2316 for ANK2.



ANK2TSPKRQDDCTGSCSVALAKETPTGLTEEAA>C<DEGQRTFGSSAHKT-----QTDSEVQESTA2341
ANK1------------------------------>-<------------------------------
ANK3TNNKSQKEKLSHVLVHDVRENHIGHPESKS>V<DQKNEFMSVTERERKLLTNGSLSEIKEMTV2921
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C2316Yc.6947G>A Putative BenignSIFT: tolerated
Polyphen: benign