Paralogue Annotation for ANK2 residue 2362

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2362
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2362

No paralogue variants have been mapped to residue 2362 for ANK2.



ANK2ALPLPEASVKTD---------------T-G>T<ESKPQGVIRSPQGL----------ELALPS2382
ANK1------------------------------>-<------------------------------
ANK3VLYR-EYVVKEGDHPGGLLDQPSRRSESSA>V<SHIPVRVADERRMLSSNIPDGFCEQSAFPK2987
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2362Pc.7084A>C Putative BenignSIFT: deleterious
Polyphen: benign
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510
p.T2362Nc.7085C>A Putative BenignSIFT:
Polyphen: