Paralogue Annotation for ANK2 residue 2395

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2395
Reference Amino Acid: S - Serine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2395

No paralogue variants have been mapped to residue 2395 for ANK2.

ANK2	---------ELALPSRD---SEVLSAVADD>S<L-------------AVS-------HKDSLE	2405
ANK1	------------------------------>-<------------------------------
ANK3	SNIPDGFCEQSAFPKHELSQKLSQSSMSKE>T<VETQHFNSIEDEKVTYSEISKVSKHQSYVG	3033
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.S2395L	c.7184C>T	Putative Benign			SIFT: Polyphen: