Paralogue Annotation for ANK2 residue 2404

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2404
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2404

No paralogue variants have been mapped to residue 2404 for ANK2.



ANK2DSL-------------AVS-------HKDS>L<EASPVLED--NSSHKTPDSLEPSPLKESPC2432
ANK1------------------------------>-<------------------------------
ANK3ETVETQHFNSIEDEKVTYSEISKVSKHQSY>V<GLCPPLEETETSPTKSPDSLEFSPGKESPS3062
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L2404Pc.7211T>C Putative BenignSIFT: deleterious
Polyphen: probably damaging