Paralogue Annotation for ANK2 residue 2433

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2433
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2433

No paralogue variants have been mapped to residue 2433 for ANK2.



ANK2EASPVLED--NSSHKTPDSLEPSPLKESPC>R<DSLESSPVEPKMKAGIFPSHFPLP------2457
ANK1------------------------------>-<------------------------------
ANK3GLCPPLEETETSPTKSPDSLEFSPGKESPS>S<DVFDHSPIDGLEKLAPLAQTEGGKEIKTLP3093
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2433Hc.7298G>A Putative BenignSIFT:
Polyphen: benign
p.R2433Cc.7297C>T Putative BenignSIFT: tolerated
Polyphen: benign