Paralogue Annotation for ANK2 residue 2584

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2584
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2584

No paralogue variants have been mapped to residue 2584 for ANK2.



ANK2EMFKMVTKIKMFDELEQEAKQKRDYKKEPK>Q<EESSSSSD-----PDADCSVDVDEPKHTGS2609
ANK1------------------------------>-<------------------------------
ANK3TAVEREM----------PNDVSKDSNQRPK>N<NRVAYIEFPPPPPLDADQ-IESDKKHHYLP3275
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q2584Pc.7751A>C Putative BenignSIFT: tolerated
Polyphen: benign