Paralogue Annotation for ANK2 residue 2611

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2611
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2611

No paralogue variants have been mapped to residue 2611 for ANK2.



ANK2ESSSSSD-----PDADCSVDVDEPKHTGSG>E<DESGVPVLVTSESRKVSSSSESEPELAQLK2641
ANK1------------------------------>-<------------------------------
ANK3RVAYIEFPPPPPLDADQ-IESDKKHHYLPE>K<EVDMIEVN--------------------LQ3287
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2611Kc.7831G>A Putative BenignSIFT: tolerated
Polyphen: benign