Paralogue Annotation for ANK2 residue 2653

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2653
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2653

No paralogue variants have been mapped to residue 2653 for ANK2.



ANK2ESRKVSSSSESEPELAQLKKGADSGLLPEP>V<IRVQPPSPLPSSMD-SNSSPEEVQFQPVVS2682
ANK1------------------------------>-<------------------------------
ANK3-----------------LQDEHDKYQLAEP>V<IRVQPPSPVPPGADVSDSSDDESIYQPVPV3329
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2653Ac.7958T>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging