Paralogue Annotation for ANK2 residue 2681

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2681
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2681

No paralogue variants have been mapped to residue 2681 for ANK2.



ANK2PVIRVQPPSPLPSSMD-SNSSPEEVQFQPV>V<SKQYTFKMNE--DTQEEPGKSEEEKDSESH2709
ANK1------------------------------>-<------------------------------
ANK3PVIRVQPPSPVPPGADVSDSSDDESIYQPV>P<VKKYTFKLKEVDDEQKEKPKASAEKASNQK3358
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2681Ic.8041G>A Putative BenignSIFT: tolerated
Polyphen: benign