Paralogue Annotation for ANK2 residue 2770

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2770
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2770

No paralogue variants have been mapped to residue 2770 for ANK2.



ANK2DGHGCEAMSPSSSAAPVSSGLQSPTGDDVD>E<QPVIYKESLALQGTHEKDTEGEELDVSRAE2800
ANK1------------------------------>-<------------------------------
ANK3--FGLGLDSPQNEIAQ-----------N-->-<------------------------------3385
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2770Dc.8310A>C Putative BenignSIFT: tolerated
Polyphen: benign