Paralogue Annotation for ANK2 residue 3006

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3006
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3006

No paralogue variants have been mapped to residue 3006 for ANK2.



ANK2SSSFEPTMSATTTVVGEQIS---KVIITKT>D<VDSDSWSEIREDDEAFEARVKEEEQKIFGL3036
ANK1------------------------------>-<------------------------------
ANK3-------TYFSYK-VDEEFATPFKT-VATK>G<LDFDPWSNNRGDDEVFDSKSREDETKPFGL3569
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3006Gc.9017A>G Putative BenignSIFT:
Polyphen: probably damaging