Paralogue Annotation for ANK2 residue 3033

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3033
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3033

No paralogue variants have been mapped to residue 3033 for ANK2.



ANK2TKTDVDSDSWSEIREDDEAFEARVKEEEQK>I<FGLMVDRQSQGTTPDTTPARTPTEEGTPTS3063
ANK1------------------------------>-<------------------------------
ANK3ATKGLDFDPWSNNRGDDEVFDSKSREDETK>P<FGLAVEDRSPATTPDTTPARTPTDESTPTS3596
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I3033Rc.9098T>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging