Paralogue Annotation for ANK2 residue 3037

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3037
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3037

No paralogue variants have been mapped to residue 3037 for ANK2.



ANK2VDSDSWSEIREDDEAFEARVKEEEQKIFGL>M<VDRQSQGTTPDTTPARTPTEEGTPTSEQNP3067
ANK1------------------------------>-<------------------------------
ANK3LDFDPWSNNRGDDEVFDSKSREDETKPFGL>A<VEDRSPATTPDTTPARTPTDESTPTSEPNP3600
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M3037Ic.9111G>A Putative BenignSIFT:
Polyphen: possibly damaging