Paralogue Annotation for ANK2 residue 3095

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3095
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3095

No paralogue variants have been mapped to residue 3095 for ANK2.



ANK2QNPFLFQEGKLFEMTRSGAIDMTKRSYADE>S<FHFFQIGQESREETLSEDVKEGA-T--GAD3122
ANK1------------------------------>-<------------------------------
ANK3PNPFPFHEGKMFEMTRSGAIDMSKRDFVEE>R<LQFFQIGEHTSEGK-SGDQGEGDKSMVTAT3657
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3095Nc.9284G>A Putative BenignSIFT:
Polyphen: benign