Paralogue Annotation for ANK2 residue 3121

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3121
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3121

No paralogue variants have been mapped to residue 3121 for ANK2.



ANK2ESFHFFQIGQESREETLSEDVKEGA-T--G>A<DPLPL--ETSAESLALSESKETVDDEADLL3149
ANK1------------------------------>-<------------------------------
ANK3ERLQFFQIGEHTSEGK-SGDQGEGDKSMVT>A<TPQPQSGDTTVET-NLERNVETPTVEPNPS3685
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3121Sc.9361G>T Putative BenignSIFT: tolerated
Polyphen: benign