Paralogue Annotation for ANK2 residue 3141

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3141
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3141

No paralogue variants have been mapped to residue 3141 for ANK2.



ANK2EGA-T--GADPLPL--ETSAESLALSESKE>T<VDDEADLLPDDVSEEVEEIPAS------DA3165
ANK1------------------------------>-<------------------------------
ANK3EGDKSMVTATPQPQSGDTTVET-NLERNVE>T<PTVEPNPSI-PTSGECQEGTSSSGSLEKSA3706
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3141Ac.9421A>G Putative BenignSIFT: tolerated
Polyphen: benign