Paralogue Annotation for ANK2 residue 3170

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3170
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3170

No paralogue variants have been mapped to residue 3170 for ANK2.



ANK2EEIPAS------DAQLNS------------>Q<MGISASTETPTKEAVSVGTKDLPTVQTGDI3200
ANK1------------------------------>-<------------------------------
ANK3QEGTSSSGSLEKSAAATNTSKVDPKLRTPI>K<MGISASTMTMKKEGPGEITDKIEAVMTSCQ3753
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q3170Hc.9510A>T Putative BenignSIFT:
Polyphen: benign