Paralogue Annotation for ANK2 residue 3203

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 3203
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 3203

No paralogue variants have been mapped to residue 3203 for ANK2.



ANK2SASTETPTKEAVSVGTKDLPTVQTGDIPP->L<SGVKQISCPDSSEPAVQVQLDFSTLTRSVY3233
ANK1------------------------------>-<------------------------------
ANK3SASTMTMKKEGPGEITDKIEAVMTSCQGLE>N<ETITMISNTANSQMGVRPHEK-HDFQKDNF3786
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3203Fc.9607C>T UnknownSIFT:
Polyphen: benign